PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C016456P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 496aa    MW: 57102.6 Da    PI: 10.2594
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C016456P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding30.86.6e-10225270146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r++WT+ Ed+ l+  ++q G ++W  Ia  +g++Rt+ qc sr+q 
   MELO3C016456P1 225 RDPWTASEDKNLLFTIQQKGLNNWIEIAVSLGTNRTPFQCLSRYQR 270
                      789*****************************************96 PP

2Myb_DNA-binding41.14.1e-13279322246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                        WT++Ed++l  av+ +G ++W ++a+t+  gR + qc +rw k
   MELO3C016456P1 279 REWTKDEDDKLRSAVAIFGVRDWQAVASTLE-GRAGTQCSNRWKK 322
                      68*****************************.***********98 PP

3Myb_DNA-binding322.9e-10331376147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg +T+ Ed +l+ av ++G+++W++ a+ ++ gR   qc++rw++ 
   MELO3C016456P1 331 RGYFTPYEDVRLKIAVMLFGPKNWNKKAEFLP-GRNQVQCRERWFNC 376
                      799*****************************.***********996 PP

4Myb_DNA-binding49.97.2e-16383427147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r  WT+eEd++l  a++++G   W+++a++++  Rt+++c+ rw k+
   MELO3C016456P1 383 RCEWTEEEDLRLEIAIQEHGYS-WAKVAACVP-SRTDNECRRRWKKL 427
                      568*****************99.*********.***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.564120219IPR017877Myb-like domain
SMARTSM007171.9124221IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.5E-9128143IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-9192232IPR009057Homeodomain-like
SuperFamilySSF466893.95E-17201269IPR009057Homeodomain-like
PROSITE profilePS500909.396220272IPR017877Myb-like domain
SMARTSM007173.2E-6224274IPR001005SANT/Myb domain
PfamPF002491.1E-7225270IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-14233280IPR009057Homeodomain-like
SuperFamilySSF466896.65E-19257327IPR009057Homeodomain-like
PROSITE profilePS5129419.892273328IPR017930Myb domain
SMARTSM007178.3E-11277326IPR001005SANT/Myb domain
PfamPF002493.9E-11279322IPR001005SANT/Myb domain
CDDcd001674.44E-9280324No hitNo description
Gene3DG3DSA:1.10.10.601.1E-15281327IPR009057Homeodomain-like
SuperFamilySSF466891.23E-24328424IPR009057Homeodomain-like
PROSITE profilePS5129410.019329377IPR017930Myb domain
SMARTSM007171.8E-7330379IPR001005SANT/Myb domain
PfamPF002493.4E-9331376IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.9E-18333383IPR009057Homeodomain-like
CDDcd001672.07E-6334375No hitNo description
PROSITE profilePS5129423.87378432IPR017930Myb domain
SMARTSM007178.1E-14382430IPR001005SANT/Myb domain
PfamPF002491.1E-14383427IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-18384427IPR009057Homeodomain-like
CDDcd001674.28E-11385428No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 496 aa     Download sequence    Send to blast
MLAFEKGSLP KAALAFVDAI KKNRSQQKFI RSKMIHLEAR IEENKKLRKR CKILKDFQCS  60
CKRRTSSALS QMIDPRVQLI SAAKPQAKDS SKKDKRLSGM YYGPAENSHV ACHRMALAKF  120
PRVDRKKWSI VERENLGKGI RQQFQEMVLQ ISVDQFSGQQ GVSGDSDDLD NILASIKDLD  180
IAPEKIREFL PKVNWDKLAS MYLQGRSGAE CEARWLNFED PLINRDPWTA SEDKNLLFTI  240
QQKGLNNWIE IAVSLGTNRT PFQCLSRYQR SLNASILKRE WTKDEDDKLR SAVAIFGVRD  300
WQAVASTLEG RAGTQCSNRW KKSLDPARTK RGYFTPYEDV RLKIAVMLFG PKNWNKKAEF  360
LPGRNQVQCR ERWFNCLDPS LRRCEWTEEE DLRLEIAIQE HGYSWAKVAA CVPSRTDNEC  420
RRRWKKLFPD EVPLLQEARK IQKAALISNF VDRETERPAL GPADFRPRPN TDLLCNTDGP  480
RPVPKRNVKT RLVST*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C8e-321974322155MYB PROTO-ONCOGENE PROTEIN
1h89_C8e-321974322155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818581e-178LN681858.1 Cucumis melo genomic scaffold, anchoredscaffold00028.
GenBankLN7132601e-178LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008452207.10.0PREDICTED: snRNA-activating protein complex subunit 4
RefseqXP_008452208.10.0PREDICTED: snRNA-activating protein complex subunit 4
RefseqXP_008452209.10.0PREDICTED: snRNA-activating protein complex subunit 4
TrEMBLA0A0A0L2R20.0A0A0A0L2R2_CUCSA; Uncharacterized protein
STRINGPOPTR_0015s04260.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.20.0myb domain protein 4r1